Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989)

This Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0961/MT0989

UniProt

P64775

Expression Region

1-115

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 (CVID3/429), CF594 conjugate, 0.1mg/mL
BNC940429-100 1x 100 µL

CD19 (CVID3/429), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Kappa Light Chain Antibody
RC-16470-01 50 μL

Recombinant Human Kappa Light Chain Antibody

Sign In for Pricing
View Details
Recombinant Human Kappa Light Chain Antibody
RC-16470-02 100 µL

Recombinant Human Kappa Light Chain Antibody

Sign In for Pricing
View Details
Recombinant Human Kappa Light Chain Antibody
RC-16470-03 1 mL

Recombinant Human Kappa Light Chain Antibody

Sign In for Pricing
View Details
PBOV1 Antibody
8C11669-AAT 50 µg

PBOV1 Antibody

Sign In for Pricing
View Details
FMNL3 (NM_198900) Human Recombinant Protein
TP312876M 100 µg

FMNL3 (NM_198900) Human Recombinant Protein

Sign In for Pricing
View Details