Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989)

This Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0961/MT0989

UniProt

P64775

Expression Region

1-115

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitronectin Receptor / CD51 / CD61 (23C6), CF647 conjugate, 0.1mg/mL
BNC471471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat IFN-γ Protein (His Tag)
PDER100254-01 20 µg

Recombinant Rat IFN-γ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat IFN-γ Protein (His Tag)
PDER100254-02 100 µg

Recombinant Rat IFN-γ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat IFN-γ Protein (His Tag)
PDER100254-03 500 µg

Recombinant Rat IFN-γ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat IFN-γ Protein (His Tag)
PDER100254-04 1 mg

Recombinant Rat IFN-γ Protein (His Tag)

Sign In for Pricing
View Details
Tecrl Mouse Gene Knockout Kit (CRISPR)
KN517391 1 Kit

Tecrl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details