Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989)

This Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0961/MT0989

UniProt

P64775

Expression Region

1-115

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCPTP (PTPN2) Human Gene Knockout Kit (CRISPR)
KN202161RB 1 Kit

TCPTP (PTPN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL
BNC040903-500 1x 500 µL

Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF568 conjugate, 0.1mg/mL
BNC683566-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly-6G/Ly-6C Antibody[RB6-8C5]
E-AB-F1120T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse Ly-6G/Ly-6C Antibody[RB6-8C5]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly-6G/Ly-6C Antibody[RB6-8C5]
E-AB-F1120T-02 100 Tests

Elab Fluor® Violet 610 Anti-Mouse Ly-6G/Ly-6C Antibody[RB6-8C5]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse Ly-6G/Ly-6C Antibody[RB6-8C5]
E-AB-F1120T-03 2x 100 Tests

Elab Fluor® Violet 610 Anti-Mouse Ly-6G/Ly-6C Antibody[RB6-8C5]

Sign In for Pricing
View Details