Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0986 (Mb0986)

This Recombinant Uncharacterized protein Mb0986 (Mb0986) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0986

UniProt

P64776

Expression Region

1-115

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ficoll Plus 1.083
P4360 200 mL

Ficoll Plus 1.083

Sign In for Pricing
View Details
ACSF3 Knockout HEK293T Polyclonal Cells
ARG37745 1 Million

ACSF3 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Peptidase T (pepT)
MBS1418567-01 0.02 mg (E-Coli)

Recombinant Streptococcus mutans Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Peptidase T (pepT)
MBS1418567-02 0.02 mg (Yeast)

Recombinant Streptococcus mutans Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Peptidase T (pepT)
MBS1418567-03 0.1 mg (E-Coli)

Recombinant Streptococcus mutans Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Peptidase T (pepT)
MBS1418567-04 0.1 mg (Yeast)

Recombinant Streptococcus mutans Peptidase T (pepT)

Sign In for Pricing
View Details