Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0986 (Mb0986)

This Recombinant Uncharacterized protein Mb0986 (Mb0986) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0986

UniProt

P64776

Expression Region

1-115

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MacConkey Agar, 1 pack = 250 g
BAL6662 1 Pack

MacConkey Agar, 1 pack = 250 g

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 14, TTC14 ELISA KIT
ELI-45749h 96 Tests

Human Tetratricopeptide repeat protein 14, TTC14 ELISA KIT

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)
MBS1440893-01 0.02 mg (E-Coli)

Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)
MBS1440893-02 0.1 mg (E-Coli)

Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)
MBS1440893-03 0.02 mg (Yeast)

Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)
MBS1440893-04 0.1 mg (Yeast)

Recombinant Chlorobium tepidum Single-stranded DNA-binding protein 1 (ssb1)

Sign In for Pricing
View Details