Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

P0AC45

Expression Region

1-115

Origin

Escherichia coli O6

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Staurosporine * 1 mM DMSO stock solution*
80050-AAT 100 µL

ReadiUse™ Staurosporine * 1 mM DMSO stock solution*

Sign In for Pricing
View Details
Sodium 3-(Ethoxycarbonyl)-2',4'-difluoro-[1,1'-biphenyl]-4-yl Sulfate
TRC-S743925-2.5MG 2.5 mg

Sodium 3-(Ethoxycarbonyl)-2',4'-difluoro-[1,1'-biphenyl]-4-yl Sulfate

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057G-01 20 Tests

PE/Cyanine5 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057G-02 100 Tests

PE/Cyanine5 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
N-(1,1-Dioxido-2,3-dihydro-3-thienyl)glycine
TRC-D436633-50MG 50 mg

N-(1,1-Dioxido-2,3-dihydro-3-thienyl)glycine

Sign In for Pricing
View Details