Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidH (yidH)

This Recombinant Inner membrane protein yidH (yidH) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Inner membrane protein yidH

UniProt

P0ADM3

Expression Region

1-115

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila melanogaster G-protein coupled receptor Mth (mth), partial
MBS7070886 Inquire

Recombinant Drosophila melanogaster G-protein coupled receptor Mth (mth), partial

Sign In for Pricing
View Details
CD34 Peptide - C-terminal region
orb2011314 100 µg

CD34 Peptide - C-terminal region

Sign In for Pricing
View Details
(R) -Ethyl 2- ((tert-butoxycarbonyl) amino) -3-hydroxypropanoate 100g
A23760-100000 100000 mg

(R) -Ethyl 2- ((tert-butoxycarbonyl) amino) -3-hydroxypropanoate 100g

Sign In for Pricing
View Details
Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1
MBS144495-01 0.001 mg

Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1

Sign In for Pricing
View Details
Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1
MBS144495-02 0.005 mg

Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1

Sign In for Pricing
View Details
Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1
MBS144495-03 0.05 mg

Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1

Sign In for Pricing
View Details