Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

P0AC46

Expression Region

1-115

Origin

Shigella flexneri

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant canine IL-1 alpha/IL1A protein
ATGP3976-100 100 µg

Recombinant canine IL-1 alpha/IL1A protein

Sign In for Pricing
View Details
GPR113 (ADGRF3) (NM_001145169) Human Untagged Clone
SC326309 10 µg

GPR113 (ADGRF3) (NM_001145169) Human Untagged Clone

Sign In for Pricing
View Details
3632451O06Rik AAV Vector (Mouse) (CMV)
10546104 1 µg

3632451O06Rik AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Olfr707 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
33381114 3x 1.0 µg

Olfr707 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
GABAA Rr1 shRNA Plasmid (m)
sc-42458-SH 20 µg

GABAA Rr1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Rat Monoclonal Siglec-2/CD22 Antibody (308501) [DyLight 755]
FAB2296Z 0.1 mL

Rat Monoclonal Siglec-2/CD22 Antibody (308501) [DyLight 755]

Sign In for Pricing
View Details