Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidH (yidH)

This Recombinant Inner membrane protein yidH (yidH) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Inner membrane protein yidH

UniProt

P0ADM1

Expression Region

1-115

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NucleoType Seed PCR (25)
MN 743203.25 1 Each

NucleoType Seed PCR (25)

Sign In for Pricing
View Details
PIN, FLOATING, TUBE, Stainless Steel, Hydrophobic Coated, Solid, Delivers ~120nL Hanging Drop, 0.914mm Diameter, 17mm Exposed Length, 38.1mm Total Length
FP4NH 1 Each

PIN, FLOATING, TUBE, Stainless Steel, Hydrophobic Coated, Solid, Delivers ~120nL Hanging Drop, 0.914mm Diameter, 17mm Exposed Length, 38.1mm Total Length

Sign In for Pricing
View Details
TAF5L rabbit pAb
ES3554-01 50 µL

TAF5L rabbit pAb

Sign In for Pricing
View Details
TAF5L rabbit pAb
ES3554-02 100 µL

TAF5L rabbit pAb

Sign In for Pricing
View Details
OVA Conjugated Cyclosporin A (CsA)
SDPK254Ge21-01 10 µg

OVA Conjugated Cyclosporin A (CsA)

Sign In for Pricing
View Details
OVA Conjugated Cyclosporin A (CsA)
SDPK254Ge21-02 50 µg

OVA Conjugated Cyclosporin A (CsA)

Sign In for Pricing
View Details