Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidH (yidH)

This Recombinant Inner membrane protein yidH (yidH) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Inner membrane protein yidH

UniProt

P0ADM1

Expression Region

1-115

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RT1-M3-1 ORF Vector (Rat) (pORF)
ORF075718 1.0 µg DNA

RT1-M3-1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
P21 Recombinant Mouse monoclonal Antibody
HA610098 100 µg

P21 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
CIB1 (NM_006384) Human Tagged Lenti ORF Clone
RC201591L2 10 µg

CIB1 (NM_006384) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nucleophosmin Antibody
E38PA7169 100 µL

Nucleophosmin Antibody

Sign In for Pricing
View Details
1- (Piperidin-2-yl) cyclopropan-1-ol
PJB22880-01 50 mg

1- (Piperidin-2-yl) cyclopropan-1-ol

Sign In for Pricing
View Details
1- (Piperidin-2-yl) cyclopropan-1-ol
PJB22880-02 0.5 g

1- (Piperidin-2-yl) cyclopropan-1-ol

Sign In for Pricing
View Details