Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidH (yidH)

This Recombinant Inner membrane protein yidH (yidH) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Inner membrane protein yidH

UniProt

P0ADM1

Expression Region

1-115

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PIK3R5 Protein, His-SUMO, E.coli-500ug
QP7909-ec-500ug 500ug

Recombinant Human PIK3R5 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
10-place (2 long x 5 high) upright freezer rack for 2 in H boxes, 10 15/16 in L x 5 1/2 in W x 11 in H, stainless steel
2602-2500 1 Each

10-place (2 long x 5 high) upright freezer rack for 2 in H boxes, 10 15/16 in L x 5 1/2 in W x 11 in H, stainless steel

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans mprB Protein (aa 48-163)
VAng-Yyj4101-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Ulcerans mprB Protein (aa 48-163)

Sign In for Pricing
View Details
C15orf53 Polyclonal Antibody, FITC Conjugated
A66964-050 50 µL

C15orf53 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD99 Antibody (rMIC2/8746) [DyLight 650]
NBP3-21119C 0.1 mL

Mouse Monoclonal CD99 Antibody (rMIC2/8746) [DyLight 650]

Sign In for Pricing
View Details
LOC678705 3'UTR Luciferase Stable Cell Line
TU210368 1.0 mL

LOC678705 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details