Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidH (yidH)

This Recombinant Inner membrane protein yidH (yidH) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Inner membrane protein yidH

UniProt

P0ADM2

Expression Region

1-115

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (MaxLight 490)
247560-ML490 100 µL

IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Human Myosin Light Chain 7, Regulatory (MYL7)
RPU42899-01 50 µg

Recombinant Human Myosin Light Chain 7, Regulatory (MYL7)

Sign In for Pricing
View Details
Recombinant Human Myosin Light Chain 7, Regulatory (MYL7)
RPU42899-02 100 µg

Recombinant Human Myosin Light Chain 7, Regulatory (MYL7)

Sign In for Pricing
View Details
Recombinant Human Myosin Light Chain 7, Regulatory (MYL7)
RPU42899-03 1 mg

Recombinant Human Myosin Light Chain 7, Regulatory (MYL7)

Sign In for Pricing
View Details
Recombinant Escherichia coli 50S ribosomal protein L30 (rpmD)
orb1651669-01 20 µg

Recombinant Escherichia coli 50S ribosomal protein L30 (rpmD)

Sign In for Pricing
View Details
Recombinant Escherichia coli 50S ribosomal protein L30 (rpmD)
orb1651669-02 100 µg

Recombinant Escherichia coli 50S ribosomal protein L30 (rpmD)

Sign In for Pricing
View Details