Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidH (yidH)

This Recombinant Inner membrane protein yidH (yidH) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Inner membrane protein yidH

UniProt

P0ADM2

Expression Region

1-115

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNB4 Protein Vector (Rat) (pPM-C-His)
PV270673 500 ng

GNB4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
DNA-PKCS (phospho Ser2612) Polyclonal Antibody
E20-60986 100 µg

DNA-PKCS (phospho Ser2612) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3R2me2s, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 550)
MBS6420761-01 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3R2me2s, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 550)

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3R2me2s, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 550)
MBS6420761-02 5x 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3R2me2s, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 550)

Sign In for Pricing
View Details
Kir2.2 (KCNJ12) (NM_021012) Human Untagged Clone
SC124157 10 µg

Kir2.2 (KCNJ12) (NM_021012) Human Untagged Clone

Sign In for Pricing
View Details
HBP1 Protein Lysate (Mouse) with C-HA Tag
23055034 100 µg

HBP1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details