Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized membrane protein yosE

UniProt

O31884

Expression Region

1-115

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Garinii rbfA Protein (aa 1-120)
VAng-Lsx2110-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Garinii rbfA Protein (aa 1-120)

Sign In for Pricing
View Details
Nurim (NRM) Human siRNA Oligo Duplex (Locus ID 11270)
SR307733 1 Kit

Nurim (NRM) Human siRNA Oligo Duplex (Locus ID 11270)

Sign In for Pricing
View Details
CD59 Antibody
OAEE00287-100UG 0.1 mg (C100)

CD59 Antibody

Sign In for Pricing
View Details
WDR3 (NM_006784) Human Tagged Lenti ORF Clone
RC224568L3 10 µg

WDR3 (NM_006784) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae BAG family molecular chaperone regulator 1 (bag-1)
MBS1452951-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis briggsae BAG family molecular chaperone regulator 1 (bag-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae BAG family molecular chaperone regulator 1 (bag-1)
MBS1452951-02 0.1 mg (E-Coli)

Recombinant Caenorhabditis briggsae BAG family molecular chaperone regulator 1 (bag-1)

Sign In for Pricing
View Details