Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized membrane protein yosE

UniProt

O31884

Expression Region

1-115

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-53BP2/ASPP2 Rabbit Monoclonal Antibody
M02609-2-40μl 40 µL

Anti-53BP2/ASPP2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-GSX1 Antibody Picoband® Cy3 Conjugated
A13105-1-Cy3 100 µg/Vial

Anti-GSX1 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Ccl1 shRNA (UAS) - Lentiviral mouse Ccl1 shRNA (UAS, RFP) (25)
GTR15205235 1 Vial

Lentiviral mouse Ccl1 shRNA (UAS) - Lentiviral mouse Ccl1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
FAM160B1, CT (Protein FAM160B1, FAM160B1, KIAA1600) (AP) discontinued
035402-AP 200 µL

FAM160B1, CT (Protein FAM160B1, FAM160B1, KIAA1600) (AP) discontinued

Sign In for Pricing
View Details
CD21 Recombinant Antibody, Cy5.5 Conjugated
bsm-60246R-Cy5.5 100 µL

CD21 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
LSMD1 Rabbit Polyclonal Antibody (APC)
orb1002270 100 µL

LSMD1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details