Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE (yosE) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized membrane protein yosE

UniProt

O31884

Expression Region

1-115

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrxR2 (bovine) -PR
sc-270497-PR 10 µM - 20 µL

TrxR2 (bovine) -PR

Sign In for Pricing
View Details
BIN2 Antibody - middle region
MBS3222458-01 0.1 mL

BIN2 Antibody - middle region

Sign In for Pricing
View Details
BIN2 Antibody - middle region
MBS3222458-02 5x 0.1 mL

BIN2 Antibody - middle region

Sign In for Pricing
View Details
MT-ND5 Antibody
orb684214 100 µL

MT-ND5 Antibody

Sign In for Pricing
View Details
Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit
SL2367Hu-01 48 Tests

Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit

Sign In for Pricing
View Details
Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit
SL2367Hu-02 96 Tests

Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit

Sign In for Pricing
View Details