Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 218 (Tmem218)

This Recombinant Mouse Transmembrane protein 218 (Tmem218) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Transmembrane protein 218

UniProt

Q9CQ44

Expression Region

1-115

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGMVLGVGAGVFLLALIWVLVLLLCVLLSRASGIARFSIVFVFLGALIITTVLLLFPRA SEFPAPEGEMKIVDAFFIGRYVLLAFLSAVFLGGLFLLLTHHLLEPIYAKPLRSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO19 (Center) Rabbit Polyclonal Antibody
AP52793PU-N 400 µL

MYO19 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ACOX1 Monoclonal Antibody
E-AB-81525-01 50 µL

Recombinant ACOX1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ACOX1 Monoclonal Antibody
E-AB-81525-02 100 µL

Recombinant ACOX1 Monoclonal Antibody

Sign In for Pricing
View Details
OGT (NM_181673) Human Recombinant Protein
TP324481 20 µg

OGT (NM_181673) Human Recombinant Protein

Sign In for Pricing
View Details
CBFB Human Gene Knockout Kit (CRISPR)
KN202111RB 1 Kit

CBFB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMAD5 Rabbit Monoclonal Antibody [Clone ID: 23GB2910]
TA425221 100 µL

SMAD5 Rabbit Monoclonal Antibody [Clone ID: 23GB2910]

Sign In for Pricing
View Details