Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1570 (MJ1570)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1570 (MJ1570) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1570

UniProt

Q58965

Expression Region

1-115

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWQDPLVKKFLYLIVAMVILCPLGILLVWNYGDAWGEWGPEDVAEKVGEDKVSGLLHLA DIWSYAPLPDYDIPGWDDPFHASIGYIISAIVGVILCVGAYYALIKIVNPKAAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Qpct Mouse Gene Knockout Kit (CRISPR)
KN514303 1 Kit

Qpct Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF647 conjugate, 0.1mg/mL
BNC471991-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
7-epi-Cephalomannine
TRC-C258515-25MG 25 mg

7-epi-Cephalomannine

Sign In for Pricing
View Details
LGR5 (NM_003667) Human Recombinant Protein
TP762667 50 µg

LGR5 (NM_003667) Human Recombinant Protein

Sign In for Pricing
View Details
Human PIGO activation kit by CRISPRa
GA113673 1 Kit

Human PIGO activation kit by CRISPRa

Sign In for Pricing
View Details
Human ANKLE1 activation kit by CRISPRa
GA114952 1 Kit

Human ANKLE1 activation kit by CRISPRa

Sign In for Pricing
View Details