Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interferon alpha-inducible protein 6 (IFI6)

This Recombinant Bovine Interferon alpha-inducible protein 6 (IFI6) spans the amino acid sequence from region 20-134.

Product Specifications

Product Name Alternative

Interferon alpha-inducible protein 6, Interferon-induced protein 6-16, Ifi-6-16

UniProt

Q6IED8

Expression Region

20-134

Origin

Bos taurus (Bovine)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CCEEEDEKRYSEENSDSSFWGMVTYMAVGGGLMAAALPMLGFASTGIAANSLASSLMSWS AVANGGGVPAGGLVATLQSLGASGGSALMAKIGAFLGYTVHKQVESRQKESKEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF740 conjugate, 0.1mg/mL
BNC741149-100 1x 100 µL

CD71 (TFRC/1149), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF740 conjugate, 0.1mg/mL
BNC742343-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details