Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus B Non-structural protein 1, peptide 1

This Recombinant Rotavirus B Non-structural protein 1, peptide 1 spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Non-structural protein 1, peptide 1, NSP1 peptide 1, NSP1-1

UniProt

Q86516

Expression Region

1-115

Origin

Rotavirus B (isolate Rat/United States/IDIR/1984) (RV-B) (Rotavirus B (isolate infectious diarrhea of infant rats) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRQSSAQLNSHLTQISSQHSNLYISDSKTSTFQTQHIILVAGVGIIVALFILLVCSCV LNCYLCNKFKRENGIQSISKRSLRQSRPSPNLYVQPVMQSNPFIKEARESICSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (BSG/963), CF405S conjugate, 0.1mg/mL
BNC040963-100 1x 100 µL

CD147 (BSG/963), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF647 conjugate, 0.1mg/mL
BNC470779-500 1x 500 µL

CD30 (Ki-1/779), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details