Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus B Non-structural protein 1, peptide 1

This Recombinant Rotavirus B Non-structural protein 1, peptide 1 spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Non-structural protein 1, peptide 1, NSP1 peptide 1, NSP1-1

UniProt

Q86516

Expression Region

1-115

Origin

Rotavirus B (isolate Rat/United States/IDIR/1984) (RV-B) (Rotavirus B (isolate infectious diarrhea of infant rats) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRQSSAQLNSHLTQISSQHSNLYISDSKTSTFQTQHIILVAGVGIIVALFILLVCSCV LNCYLCNKFKRENGIQSISKRSLRQSRPSPNLYVQPVMQSNPFIKEARESICSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoA1 Protein (C-His, Human)
P513231 100 µg

ApoA1 Protein (C-His, Human)

Sign In for Pricing
View Details
EVC Rabbit pAb
E45R19262N-100 100 µL

EVC Rabbit pAb

Sign In for Pricing
View Details
Usp21 Rat shRNA Lentiviral Particle (Locus ID 688466)
TL708469V 500 µL Each

Usp21 Rat shRNA Lentiviral Particle (Locus ID 688466)

Sign In for Pricing
View Details
Human Galectin 12 (GAL12) ELISA Kit
MBS459452-01 48 Tests

Human Galectin 12 (GAL12) ELISA Kit

Sign In for Pricing
View Details
Human Galectin 12 (GAL12) ELISA Kit
MBS459452-02 96 Tests

Human Galectin 12 (GAL12) ELISA Kit

Sign In for Pricing
View Details
Human Galectin 12 (GAL12) ELISA Kit
MBS459452-03 5x 96 Tests

Human Galectin 12 (GAL12) ELISA Kit

Sign In for Pricing
View Details