Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

Q8X9A9

Expression Region

1-115

Origin

Escherichia coli O157:H7

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human AFAP1L2 Polyclonal Antibody
PHK95201 100 μg

Anti-Human AFAP1L2 Polyclonal Antibody

Sign In for Pricing
View Details
CDKL3 (NKIAMRE, Cyclin-dependent Kinase-like 3, CDKL 3, CDKL-3) (Biotin)
301329-Biotin 100 µL

CDKL3 (NKIAMRE, Cyclin-dependent Kinase-like 3, CDKL 3, CDKL-3) (Biotin)

Sign In for Pricing
View Details
Guinea Pig BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1 ELISA kit
GTR10467067 96 Well

Guinea Pig BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1 ELISA kit

Sign In for Pricing
View Details
BZRAP1 CRISPR Knock Out 293T Cell Line (Human)
13592141 1x 10^6 Cells / 1.0 mL

BZRAP1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SPARC Polyclonal Antibody
MBS9246137-01 0.1 mL

SPARC Polyclonal Antibody

Sign In for Pricing
View Details
SPARC Polyclonal Antibody
MBS9246137-02 5x 0.1 mL

SPARC Polyclonal Antibody

Sign In for Pricing
View Details