Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

Q8X9A9

Expression Region

1-115

Origin

Escherichia coli O157:H7

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r27 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3099405 3x 1.0 µg

Vmn2r27 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral human BHLHB9 sgRNA gene knockout kit - Lentiviral human BHLHB9 sgRNA gene knockout kit (25)
GTR15400395 1 Vial

Lentiviral human BHLHB9 sgRNA gene knockout kit - Lentiviral human BHLHB9 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
GNE (GLCNE, Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine Kinase, UDP-GlcNAc-2-epimerase/ManAc Kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-GlcNAc-2-epimerase, Uridine Diphosphate-N-acetylglucosamine-2-epimerase, N-acetylmannosa
MBS6380044-01 0.1 mL

GNE (GLCNE, Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine Kinase, UDP-GlcNAc-2-epimerase/ManAc Kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-GlcNAc-2-epimerase, Uridine Diphosphate-N-acetylglucosamine-2-epimerase, N-acetylmannosa

Sign In for Pricing
View Details
GNE (GLCNE, Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine Kinase, UDP-GlcNAc-2-epimerase/ManAc Kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-GlcNAc-2-epimerase, Uridine Diphosphate-N-acetylglucosamine-2-epimerase, N-acetylmannosa
MBS6380044-02 5x 0.1 mL

GNE (GLCNE, Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine Kinase, UDP-GlcNAc-2-epimerase/ManAc Kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-GlcNAc-2-epimerase, Uridine Diphosphate-N-acetylglucosamine-2-epimerase, N-acetylmannosa

Sign In for Pricing
View Details
MLL1, CT (KMT2A) (MaxLight 490)
MBS6321125-01 0.1 mL

MLL1, CT (KMT2A) (MaxLight 490)

Sign In for Pricing
View Details
MLL1, CT (KMT2A) (MaxLight 490)
MBS6321125-02 5x 0.1 mL

MLL1, CT (KMT2A) (MaxLight 490)

Sign In for Pricing
View Details