Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG)

This Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q9CP52

Expression Region

1-115

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQTLLLGYAIIAIVIVFLILIQQGKGADAGASFGGGASGTIFGSVGSGNFLSKMTALLA TAFFVMSIVIGNVNSHRNNVKQGKFDDLSATAEQIQQQQKIDAPAVETKNSDIPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Middle East Respiratory Syndrome Coronavirus Nucleic Acid Detection Kit (Fluorescence PCR)
HWTS-RT031A 1 Kit

Middle East Respiratory Syndrome Coronavirus Nucleic Acid Detection Kit (Fluorescence PCR)

Sign In for Pricing
View Details
YER084W-A Antibody
orb850058 2 mg

YER084W-A Antibody

Sign In for Pricing
View Details
Anti-Zinc finger protein GLI2 GLI2 Antibody Picoband®
A00701-5 100 µg/Vial

Anti-Zinc finger protein GLI2 GLI2 Antibody Picoband®

Sign In for Pricing
View Details
PHC3 Protein Vector (Mouse) (pPB-N-His)
PV215619 500 ng

PHC3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (MaxLight 490)
MBS6202811-01 0.1 mL

RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (MaxLight 490)

Sign In for Pricing
View Details
RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (MaxLight 490)
MBS6202811-02 5x 0.1 mL

RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (MaxLight 490)

Sign In for Pricing
View Details