Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG)

This Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q9CP52

Expression Region

1-115

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQTLLLGYAIIAIVIVFLILIQQGKGADAGASFGGGASGTIFGSVGSGNFLSKMTALLA TAFFVMSIVIGNVNSHRNNVKQGKFDDLSATAEQIQQQQKIDAPAVETKNSDIPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU1 Rabbit Polyclonal Antibody
orb577806 100 µL

STAU1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GTPase HRAS Antibody Picoband® (HRP Conjugate)
A00114-HRP 100 µg/Vial

Anti-GTPase HRAS Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Follicle Stimulating Hormone, beta 2 (FSHb2) (HRP) discontinued
F5900-21B-HRP 100 µL

Follicle Stimulating Hormone, beta 2 (FSHb2) (HRP) discontinued

Sign In for Pricing
View Details
Bapineuzumab Human Monoclonal Antibody
orb2978210-01 100 µg

Bapineuzumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Bapineuzumab Human Monoclonal Antibody
orb2978210-02 1 mg

Bapineuzumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Human RDH5 Protein Lysate 20ug
IHURDH5PLLY20UG 20 µg

Human RDH5 Protein Lysate 20ug

Sign In for Pricing
View Details