Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG)

This Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q9CP52

Expression Region

1-115

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQTLLLGYAIIAIVIVFLILIQQGKGADAGASFGGGASGTIFGSVGSGNFLSKMTALLA TAFFVMSIVIGNVNSHRNNVKQGKFDDLSATAEQIQQQQKIDAPAVETKNSDIPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S 38093
S8598-2mg 2 mg

S 38093

Sign In for Pricing
View Details
ANXA4
CSB-CL001845HU1 10 μg Plasmid + 200 μL Glycerol

ANXA4

Sign In for Pricing
View Details
Sheep monocyte chemotactic protein 3 (MCP-3; CCL7) ELISA Kit
YP-W79397-01 48 Tests

Sheep monocyte chemotactic protein 3 (MCP-3; CCL7) ELISA Kit

Sign In for Pricing
View Details
Sheep monocyte chemotactic protein 3 (MCP-3; CCL7) ELISA Kit
YP-W79397-02 96 Tests

Sheep monocyte chemotactic protein 3 (MCP-3; CCL7) ELISA Kit

Sign In for Pricing
View Details
MEK1 Antibody
orb1333898 100 µg

MEK1 Antibody

Sign In for Pricing
View Details
COQ7 Human Over-expression Lysate
orb1369106 20 µg

COQ7 Human Over-expression Lysate

Sign In for Pricing
View Details