Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C7orf66 (C7orf66)

This Recombinant Human Uncharacterized protein C7orf66 (C7orf66) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Uncharacterized protein C7orf66

UniProt

A4D0T2

Expression Region

1-115

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAVMTPSDGLSQLSVPHLTHQRLWSLSCLAMLFQAVLILSAPQMSCLLKCFYALDPLHP VMSEEFSAQYRHMMDQRYRTRIHEGYISQVKGAYLRIVHKKPISYAKSFPKEMGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dibutylamine-d4
TRC-D462739-1MG 1 mg

Dibutylamine-d4

Sign In for Pricing
View Details
NDUFB9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B7]
TA502567AM 100 µL

NDUFB9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B7]

Sign In for Pricing
View Details
Amacr Mouse Gene Knockout Kit (CRISPR)
KN501178 1 Kit

Amacr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ISLR Human Gene Knockout Kit (CRISPR)
KN205281BN 1 Kit

ISLR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
α-Cholestane
TRC-C431700-50MG 50 mg

α-Cholestane

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560292 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details