Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea mariana Defender against cell death 1 (DAD1)

This Recombinant Picea mariana Defender against cell death 1 (DAD1) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Defender against cell death 1, DAD-1

UniProt

O65085

Expression Region

1-115

Origin

Picea mariana (Black spruce) (Abies mariana)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTSTAKEAHALIASLRSAYSATPTKLKIIDLYVVYAILTAVVQVVYMAIVGSFPFNAFL SGVLSCTGTAVLAVCLRMQVNKENREFKDLPPERAFADFVLCNLVLHLVIMNFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (Bra7G), 1mg/mL
BNUM0302-50 1x 50 µL

CD43 (Bra7G), 1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684), CF405S conjugate, 0.1mg/mL
BNC040684-100 1x 100 µL

CD68 (C68/684), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details