Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P0A220

Expression Region

1-116

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALV ALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mast Cell Tryptase Recombinant Rabbit monoclonal Antibody
IRS041 100 µL

Mast Cell Tryptase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Hordenine
TRC-H669600-25MG 25 mg

Hordenine

Sign In for Pricing
View Details
Octahydroisobenzofuran
TRC-O585460-5G 5 g

Octahydroisobenzofuran

Sign In for Pricing
View Details
Recombinant Human EG-VEGF/prokineticin-1 Protein (His Tag)
PKSH032003 50 µg

Recombinant Human EG-VEGF/prokineticin-1 Protein (His Tag)

Sign In for Pricing
View Details
GIRK1/KIR3.1/KCNJ3 (Ab-185) Antibody
8B1030-AAT 50 µg

GIRK1/KIR3.1/KCNJ3 (Ab-185) Antibody

Sign In for Pricing
View Details
1-[(4R,5R)-4,5-Dihydroxy-L-ornithine]-Echinocandin B Hydrochloride
TRC-E325645-50MG 50 mg

1-[(4R,5R)-4,5-Dihydroxy-L-ornithine]-Echinocandin B Hydrochloride

Sign In for Pricing
View Details