Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P0A220

Expression Region

1-116

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALV ALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Bis(4-nitrophenyl)urea
TRC-B508500-5G 5 g

1,3-Bis(4-nitrophenyl)urea

Sign In for Pricing
View Details
Hdgfl3 (NM_013886) Mouse Tagged ORF Clone
MG202094 10 µg

Hdgfl3 (NM_013886) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OR9G1 Antibody
8G697-AAT 50 µg

OR9G1 Antibody

Sign In for Pricing
View Details
Human AHDC1 activation kit by CRISPRa
GA109081 1 Kit

Human AHDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
PTTG1IP Rabbit Polyclonal Antibody
AP31754PU-N 50 µL

PTTG1IP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF740 conjugate, 0.1mg/mL
BNC740489-500 1x 500 µL

Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details