Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P0A220

Expression Region

1-116

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALV ALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00518 Human qPCR Primer Pair (NM_152738)
HP217934 200 Reactions

LINC00518 Human qPCR Primer Pair (NM_152738)

Sign In for Pricing
View Details
TissueScan, Lymphoma cDNA Array II
LYRT302 5 Panels

TissueScan, Lymphoma cDNA Array II

Sign In for Pricing
View Details
ROR2 Mouse Monoclonal Antibody [Clone ID: OTI3H3]
CF810008 100 µg

ROR2 Mouse Monoclonal Antibody [Clone ID: OTI3H3]

Sign In for Pricing
View Details
CXCL14 Polyclonal Antibody
AN006120L-01 25 µL

CXCL14 Polyclonal Antibody

Sign In for Pricing
View Details
CXCL14 Polyclonal Antibody
AN006120L-02 100 µL

CXCL14 Polyclonal Antibody

Sign In for Pricing
View Details
Ribonuclease 3 Mouse Monoclonal Antibody [5G4]
EM1801-17 100 µL

Ribonuclease 3 Mouse Monoclonal Antibody [5G4]

Sign In for Pricing
View Details