Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage IKe Head virion protein G6P (VI)

This Recombinant Enterobacteria phage IKe Head virion protein G6P (VI) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Head virion protein G6P, Coat protein D, G6P

UniProt

P03674

Expression Region

1-116

Origin

Enterobacteria phage IKe (Bacteriophage IKe)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPALLGIPALIRFIMGLVPIAIGYFAKFLGMIITRNGLMASALIGAILSVVSFSIQLLGD ALSSSMGGISADFGNLMSSVLPDGTTTCITVIITTRIAVFVFDIKDRLLGIANKVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details