Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant White clover mosaic virus Movement protein TGB2 (ORF3)

This Recombinant White clover mosaic virus Movement protein TGB2 (ORF3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Movement protein TGB2, 13 kDa protein, Triple gene block 2 protein, TGBp2

UniProt

P09500

Expression Region

1-116

Origin

White clover mosaic virus (strain M) (WCMV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLTPPPNPQKTYQIAILALGLVLLAFVLISDHSPKVGDHLHNLPFGGEYKDGTKSIKYF QRPNQHSLSKTLAKSHNTTIFLLILGLIVTLHGLHYFNNNRRVSSSLHCVLCQNKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spastin (Sp 3G11-1), CF568 conjugate, 0.1mg/mL
BNC682844-500 1x 500 µL

Spastin (Sp 3G11-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL
BNC741828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF647 conjugate, 0.1mg/mL
BNC472348-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF594 conjugate, 0.1mg/mL
BNC941138-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details