Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P0A219

Expression Region

1-116

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALV ALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF300 Human Gene Knockout Kit (CRISPR)
KN419156 1 Kit

ZNF300 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR75-ASB3 (N-term) Rabbit Polyclonal Antibody
AP50269PU-N 400 µL

GPR75-ASB3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prr5l Mouse Gene Knockout Kit (CRISPR)
KN514003 1 Kit

Prr5l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KDM6A (NM_021140) Human Recombinant Protein
TP310861 20 µg

KDM6A (NM_021140) Human Recombinant Protein

Sign In for Pricing
View Details
Strept. Avidin Peroxidase Colloidal Gold, 1mL 15nm
HGA-02-15 1 mL

Strept. Avidin Peroxidase Colloidal Gold, 1mL 15nm

Sign In for Pricing
View Details
Neotame-d3
TRC-N390062-1MG 1 mg

Neotame-d3

Sign In for Pricing
View Details