Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P0A219

Expression Region

1-116

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALV ALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac-3-Octadecanamido-2-ethoxypropan-1-ol Phosphocholine
TRC-O234000-5MG 5 mg

rac-3-Octadecanamido-2-ethoxypropan-1-ol Phosphocholine

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (HPV16/1058), Biotin conjugate, 0.1mg/mL
BNCB1058-500 1x 500 µL

Human Papillomavirus 16 (HPV-16) (HPV16/1058), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ADCK2 activation kit by CRISPRa
GA114074 1 Kit

Human ADCK2 activation kit by CRISPRa

Sign In for Pricing
View Details
LELP1 Mouse Monoclonal Antibody [Clone ID: OTI3D5]
CF808514 100 µg

LELP1 Mouse Monoclonal Antibody [Clone ID: OTI3D5]

Sign In for Pricing
View Details
Recombinant Human EphA7/EHK3 Protein (His & GST Tag)
PKSH030354 50 µg

Recombinant Human EphA7/EHK3 Protein (His & GST Tag)

Sign In for Pricing
View Details
HRP Conjugated Robinia pseudoacacia (Black Locust) -RPA-
H-4101-1 1 mg

HRP Conjugated Robinia pseudoacacia (Black Locust) -RPA-

Sign In for Pricing
View Details