Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P0A219

Expression Region

1-116

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALV ALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoic Acid Receptor alpha (RARA) (NM_001145301) Human Over-expression Lysate
LC428804 20 µg

Retinoic Acid Receptor alpha (RARA) (NM_001145301) Human Over-expression Lysate

Sign In for Pricing
View Details
SF4 (SUGP1) Human Gene Knockout Kit (CRISPR)
KN419468 1 Kit

SF4 (SUGP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rmdn2 Mouse Gene Knockout Kit (CRISPR)
KN514857 1 Kit

Rmdn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4,4'-Bis(isocyanatophenyl)oxide
TRC-B448770-100MG 100 mg

4,4'-Bis(isocyanatophenyl)oxide

Sign In for Pricing
View Details
MAPT / TAU pThr205 Rabbit Polyclonal Antibody
AP02400PU-N 100 µL

MAPT / TAU pThr205 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL-31 protein (N-His)
PKSM041477-01 20 µg

Recombinant Mouse IL-31 protein (N-His)

Sign In for Pricing
View Details