Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ajellomyces capsulata Assembly factor CBP4 (CBP4)

This Recombinant Ajellomyces capsulata Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA-processing protein 4

UniProt

A6R620

Expression Region

1-116

Origin

Ajellomyces capsulata (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRIGTTVKMIVAGVLLCIGGPALVQYVRPTEEELFQKFNPELQKRNLETRDQRQKDFDS FVTQLKTHAKSDKSIWHAIKESETTNRREVETRRKAELEEAERQKAQIRKELAEGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Feline IgG1 Isotype Control antibody , APC
E55A08823 50 Tests

Feline IgG1 Isotype Control antibody , APC

Sign In for Pricing
View Details
Rabbit Polyclonal PODNL1 Antibody [Alexa Fluor 594]
NBP3-05990AF594 0.1 mL

Rabbit Polyclonal PODNL1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
LTV1 Rabbit Polyclonal Antibody
TA358806 100 µL

LTV1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Interleukin 17C (IL17C) ELISA Kit
RD-IL17C-Hu-01 96 Tests

Human Interleukin 17C (IL17C) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 17C (IL17C) ELISA Kit
RD-IL17C-Hu-02 48 Tests

Human Interleukin 17C (IL17C) ELISA Kit

Sign In for Pricing
View Details
Olfm1 Mouse shRNA Plasmid (Locus ID 56177)
TR503099 1 Kit

Olfm1 Mouse shRNA Plasmid (Locus ID 56177)

Sign In for Pricing
View Details