Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_137 (MTH_137)

This Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_137 (MTH_137) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Uncharacterized protein MTH_137

UniProt

O26240

Expression Region

1-116

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSSVGEFMIYQVIGTVIGIAGIIVSFARFRESRTSPGGLLLWLILWVSVILFSLNPPFS TRIANLLGIGRGLDFLLIIGILGAYYLLFRIYLMVDRIQQDITELVHEIALREHDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPL) (NM_001127501) Human Over-expression Lysate
LC426804 20 µg

Alkaline Phosphatase (ALPL) (NM_001127501) Human Over-expression Lysate

Sign In for Pricing
View Details
NFRKB Polyclonal Antibody
E-AB-90081-01 60 µL

NFRKB Polyclonal Antibody

Sign In for Pricing
View Details
NFRKB Polyclonal Antibody
E-AB-90081-02 120 µL

NFRKB Polyclonal Antibody

Sign In for Pricing
View Details
NFRKB Polyclonal Antibody
E-AB-90081-03 200 µL

NFRKB Polyclonal Antibody

Sign In for Pricing
View Details
N-Acetyl-S-(2-carboxypropyl)-L-cysteine Ethyl Ester (Mixture of Diastereomers)
TRC-A172020-10MG 10 mg

N-Acetyl-S-(2-carboxypropyl)-L-cysteine Ethyl Ester (Mixture of Diastereomers)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS632131 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details