Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_137 (MTH_137)

This Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_137 (MTH_137) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Uncharacterized protein MTH_137

UniProt

O26240

Expression Region

1-116

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSSVGEFMIYQVIGTVIGIAGIIVSFARFRESRTSPGGLLLWLILWVSVILFSLNPPFS TRIANLLGIGRGLDFLLIIGILGAYYLLFRIYLMVDRIQQDITELVHEIALREHDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG16L2 (Center) Rabbit Polyclonal Antibody
AP50287PU-N 400 µL

ATG16L2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF640R conjugate, 0.1mg/mL
BNC402786-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559231 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right upper lobe
CS633499 5x 5 µm

Frozen Tissue Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Human ZNF420 activation kit by CRISPRa
GA115639 1 Kit

Human ZNF420 activation kit by CRISPRa

Sign In for Pricing
View Details
PKM2 Rabbit Polyclonal Antibody
R1603-5 100 µL

PKM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details