Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Defender against cell death 1 (DAD1)

This Recombinant Solanum lycopersicum Defender against cell death 1 (DAD1) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Defender against cell death 1, DAD-1

UniProt

Q9SMC4

Expression Region

1-116

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKSSATKDAQALFHSLRSAYAATPTNLKIIDLYVIFAISTALIQVVYMAIVGSFPFNSF LSGVLSCIGTAVLAVCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-100 1x 100 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL
BNC400949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF740 conjugate, 0.1mg/mL
BNC740612-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF488A conjugate, 0.1mg/mL
BNC881176-500 1x 500 µL

EMI1 (EMI1/1176), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details