Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Type IV secretion system protein virB3 (virB3)

This Recombinant Brucella abortus Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q2YIT7

Expression Region

1-116

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNF168 Matched Antibody Pair Set [IV11497/Poly]
Z01LS-1122-LS772 5 Plates

Human RNF168 Matched Antibody Pair Set [IV11497/Poly]

Sign In for Pricing
View Details
NPR2L (NPRL2) Rabbit Polyclonal Antibody
TA339702 100 µL

NPR2L (NPRL2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD30BL Antibody
E40PV4599 50 µL

ANKRD30BL Antibody

Sign In for Pricing
View Details
ANAPC5 CRISPRa sgRNA lentivector (set of three targets)(Human)
11880121 3x 1.0µg DNA

ANAPC5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rabbit Polyclonal GCOM1 Antibody
NBP1-56359 100 µL

Rabbit Polyclonal GCOM1 Antibody

Sign In for Pricing
View Details
MMP-12 rabbit pAb
ES6262-01 50 µL

MMP-12 rabbit pAb

Sign In for Pricing
View Details