Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q49VH1

Expression Region

1-116

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLMVIGFLIFIGTYMILSVNLIRIVIGISIYTHAGNLIIMSMGNYSKNKVEPLIGE GSQNFVDPLLQAIVLTAIVIGFAMTAFLLVLVYRTYRVTKEDEIDVLRGDDDDANE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Calponin 2 Antibody (OTI2B5) [Alexa Fluor 594]
NBP2-70421AF594 0.1 mL

Mouse Monoclonal Calponin 2 Antibody (OTI2B5) [Alexa Fluor 594]

Sign In for Pricing
View Details
Alexa Fluor® 488 anti-human CD185 (CXCR5)
GT13785 25 Tests

Alexa Fluor® 488 anti-human CD185 (CXCR5)

Sign In for Pricing
View Details
Rabbit Copeptin (CPP) ELISA Kit
abx355247 96 Well

Rabbit Copeptin (CPP) ELISA Kit

Sign In for Pricing
View Details
USP32 (A-10) Alexa Fluor® 488
sc-374465 AF488 200 µg/mL

USP32 (A-10) Alexa Fluor® 488

Sign In for Pricing
View Details
ELOVL6 (NM_001130721) Human Tagged Lenti ORF Clone
RC225358L4 10 µg

ELOVL6 (NM_001130721) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NPFF Polyclonal Antibody, Cy5 Conjugated
bs-8150R-Cy5 100 µL

NPFF Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details