Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q49VH1

Expression Region

1-116

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLMVIGFLIFIGTYMILSVNLIRIVIGISIYTHAGNLIIMSMGNYSKNKVEPLIGE GSQNFVDPLLQAIVLTAIVIGFAMTAFLLVLVYRTYRVTKEDEIDVLRGDDDDANE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibroblast Growth Factor 6 (FGF6) CLIA Kit
EKU09722 96 Tests

Mouse Fibroblast Growth Factor 6 (FGF6) CLIA Kit

Sign In for Pricing
View Details
Dnmt3b Polyclonal Antibody, PE Conjugated
bs-0301R-PE 100 µL

Dnmt3b Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
DCC1 Double Nickase Plasmid (h)
sc-413127-NIC 20 µg

DCC1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal Anti-ICOSLG Antibody, Purified
AM05615PU-L 200 µg

Mouse Monoclonal Anti-ICOSLG Antibody, Purified

Sign In for Pricing
View Details
ADP/ATP translocase 1
AP80321 1 mg

ADP/ATP translocase 1

Sign In for Pricing
View Details
Histone H3 (Acetyl-Lys23) Antibody
8D0009-AAT 50 µg

Histone H3 (Acetyl-Lys23) Antibody

Sign In for Pricing
View Details