Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

Q51769

Expression Region

1-116

Origin

Pseudomonas fluorescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGVALV ALFFAWRRIYRPSAACKPGEVCAIPQVPATYKLIFWGVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casp8 (NM_001277926) Mouse Untagged Clone
MC228049 10 µg

Casp8 (NM_001277926) Mouse Untagged Clone

Sign In for Pricing
View Details
c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)
MBS6268072-01 0.1 mL

c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)

Sign In for Pricing
View Details
c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)
MBS6268072-02 5x 0.1 mL

c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)

Sign In for Pricing
View Details
DIAPH1 polyclonal antibody
BS7851-01 50 µL

DIAPH1 polyclonal antibody

Sign In for Pricing
View Details
DIAPH1 polyclonal antibody
BS7851-02 100 µL

DIAPH1 polyclonal antibody

Sign In for Pricing
View Details
Tcea2 ORF Vector (Rat) (pORF)
ORF077521 1.0 µg DNA

Tcea2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details