Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

Q51769

Expression Region

1-116

Origin

Pseudomonas fluorescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGVALV ALFFAWRRIYRPSAACKPGEVCAIPQVPATYKLIFWGVAVLVLVALGFPYVVPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC37A16P Protein Vector (Human) (pPB-N-His)
PV092467 500 ng

LRRC37A16P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GSK3 alpha Peptide
AF6336-BP 1 mg

GSK3 alpha Peptide

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF488A conjugate, 0.1mg/mL
BNC881692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thsd7b-set siRNA/shRNA/RNAi Lentivector (Rat)
46677096 4x 500 ng

Thsd7b-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Mrps18a Mouse shRNA Lentiviral Particle (Locus ID 68565)
TL504171V 500 µL Each

Mrps18a Mouse shRNA Lentiviral Particle (Locus ID 68565)

Sign In for Pricing
View Details
Fast Sulphon Black F ≥95% (TLC)
237753-01 25 g

Fast Sulphon Black F ≥95% (TLC)

Sign In for Pricing
View Details