Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1072 (MJ1072)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1072 (MJ1072) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1072

UniProt

Q58472

Expression Region

1-116

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYFGGIMAIAYAKLYEIIAKYIKDEKRAEELYNAVVEVIKEEKIIVKHELKDELKNELA TKEDIMLAEERILRYVDNRFNQLDKKMTVGFVILILLYILTNPNAIELIKLLFGVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map3k7 Mouse Gene Knockout Kit (CRISPR)
KN309739RB 1 Kit

Map3k7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cryptosporidium TaqMan RT-PCR Kit Dx
DxTM39100 24 Reactions

Cryptosporidium TaqMan RT-PCR Kit Dx

Sign In for Pricing
View Details
PRMT5 (C-term) Rabbit Polyclonal Antibody
AP11010PU-N 400 µL

PRMT5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF488A conjugate, 0.1mg/mL
BNC881448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tnfrsf4 Rabbit Monoclonal Antibody [Clone ID: R01-5C7]
TA421783 100 µL

Tnfrsf4 Rabbit Monoclonal Antibody [Clone ID: R01-5C7]

Sign In for Pricing
View Details
Mouse Wfdc18 activation kit by CRISPRa
GA201322 1 Kit

Mouse Wfdc18 activation kit by CRISPRa

Sign In for Pricing
View Details