Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1072 (MJ1072)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1072 (MJ1072) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1072

UniProt

Q58472

Expression Region

1-116

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYFGGIMAIAYAKLYEIIAKYIKDEKRAEELYNAVVEVIKEEKIIVKHELKDELKNELA TKEDIMLAEERILRYVDNRFNQLDKKMTVGFVILILLYILTNPNAIELIKLLFGVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CZIB Antibody
KC-32095-01 50 μL

CZIB Antibody

Sign In for Pricing
View Details
CZIB Antibody
KC-32095-02 100 µL

CZIB Antibody

Sign In for Pricing
View Details
CZIB Antibody
KC-32095-03 1 mL

CZIB Antibody

Sign In for Pricing
View Details
3-(Boc-amino)-2-thiophenecarboxylic Acid
TRC-B809893-50MG 50 mg

3-(Boc-amino)-2-thiophenecarboxylic Acid

Sign In for Pricing
View Details
Myc tag Recombinant Rabbit monoclonal Antibody
HA723950 100 µL

Myc tag Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Eps15l1 activation kit by CRISPRa
GA201276 1 Kit

Mouse Eps15l1 activation kit by CRISPRa

Sign In for Pricing
View Details