Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD)

This Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

Q9CP59

Expression Region

1-116

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDTPKRSNEPVVWLLFGAGTTVSAMFYPVLVLILGFLLPFGLIDPKNIIELIGFLHSPL GKLLLLVLLIFPMWGAMHRIHHGMHDFKIHIPASGVIFYGLSVLYTVLVCFAVFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM50A Rabbit Monoclonal Antibody [Clone ID: R08-2G7]
TA421939 100 µL

FAM50A Rabbit Monoclonal Antibody [Clone ID: R08-2G7]

Sign In for Pricing
View Details
CD43 (SPN/839), CF740 conjugate, 0.1mg/mL
BNC740839-500 1x 500 µL

CD43 (SPN/839), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Butanoic Acid
TRC-B692235-250G 250 g

Butanoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS647991 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Dnmt3b Antibody
KC-41809-01 50 μL

Dnmt3b Antibody

Sign In for Pricing
View Details
Dnmt3b Antibody
KC-41809-02 100 µL

Dnmt3b Antibody

Sign In for Pricing
View Details