Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD)

This Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

Q9CP59

Expression Region

1-116

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDTPKRSNEPVVWLLFGAGTTVSAMFYPVLVLILGFLLPFGLIDPKNIIELIGFLHSPL GKLLLLVLLIFPMWGAMHRIHHGMHDFKIHIPASGVIFYGLSVLYTVLVCFAVFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-M Recombinant Chimeric Antibody Antibody
HA610337 100 µL

NF-M Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human LRRC19 activation kit by CRISPRa
GA112195 1 Kit

Human LRRC19 activation kit by CRISPRa

Sign In for Pricing
View Details
Peroxidase Labeled Lectin Kit #1
HLK-001 1 mg

Peroxidase Labeled Lectin Kit #1

Sign In for Pricing
View Details
Recombinant Human CSF1R/CD115 Protein (Fc Tag)
PKSH032726-01 10 µg

Recombinant Human CSF1R/CD115 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CSF1R/CD115 Protein (Fc Tag)
PKSH032726-02 50 µg

Recombinant Human CSF1R/CD115 Protein (Fc Tag)

Sign In for Pricing
View Details
Human IL-6 Mouse Monoclonal Antibody [A6D2]
HA601050 100 µL

Human IL-6 Mouse Monoclonal Antibody [A6D2]

Sign In for Pricing
View Details