Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD)

This Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

Q9CP59

Expression Region

1-116

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDTPKRSNEPVVWLLFGAGTTVSAMFYPVLVLILGFLLPFGLIDPKNIIELIGFLHSPL GKLLLLVLLIFPMWGAMHRIHHGMHDFKIHIPASGVIFYGLSVLYTVLVCFAVFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772M1-01 20 Tests

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772M1-02 100 Tests

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772M1-03 2x 100 Tests

Elab Fluor® 700 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), 1mg/mL
BNUM1807-50 1x 50 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), 1mg/mL

Sign In for Pricing
View Details
AP2M1 Rabbit Monoclonal Antibody [Clone ID: 23GB3220]
TA424514S 20 µL

AP2M1 Rabbit Monoclonal Antibody [Clone ID: 23GB3220]

Sign In for Pricing
View Details
Mouse Cyp4a14 activation kit by CRISPRa
GA201000 1 Kit

Mouse Cyp4a14 activation kit by CRISPRa

Sign In for Pricing
View Details